HORDB

General Information

ID: hor006706
Uniprot ID: P01216(25-120)
Protein name: Glycoprotein hormones alpha chain
Gene name: Cga
Organism: Mus musculus (Mouse)
Family: Glycoprotein hormones subunit alpha family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
GO BP: GO:0006590 thyroid hormone generation; GO:0007186 G protein-coupled receptor signaling pathway; GO:0008406 gonad development; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process; GO:0030878 thyroid gland development; GO:0032275 luteinizing hormone secretion; GO:0032870 cellular response to hormone stimulus; GO:0035265 organ growth; GO:0046621 negative regulation of organ growth; GO:0046884 follicle-stimulating hormone secretion; GO:0048589 developmental growth
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex; GO:0061696 pituitary gonadotropin complex

Sequence Information

Sequence: LPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
Length: 96(25-120)
Propeptide: MDYYRKYAAVILVMLSMFLHILHSLPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
Signal peptide: MDYYRKYAAVILVMLSMFLHILHS
Modification: NA
Glycosylation: T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Activity

Function: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: 11-35; 14-64; 32-86; 36-88; 63-91
Structure ID: AF-P01216-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006706_AF2.pdb

hor006706_ESM.pdb

Physical Information

Mass:	1236212	Formula:	C463H729N127O136S13
Absent amino acids:	W	Common amino acids:	CK
pI:	8.56	Basic residues:	16
Polar residues:	38	Hydrophobic residues:	24
Hydrophobicity:	-31.04	Boman Index:	-13856
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	52.92
Instability Index:	5329.69	Extinction Coefficient cystines:	8075
Absorbance 280nm:	85

Literature

PubMed ID: 6272299
Title: Nucleotide sequence of the mRNA encoding the pre-alpha-subunit of mouse thyrotropin.
PubMed ID: 6177696
Title: alpha Subunit of rat pituitary glycoprotein hormones. Primary structure of the precursor determined from the nucleotide sequence of cloned cDNAs.
PubMed ID: 2466623
Title: Organization and nucle
PubMed ID: 12112597
Title:
PubMed ID: 15489334
Title: